SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8ZWK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G8ZWK9
Domain Number - Region: 2-21
Classification Level Classification E-value
Superfamily Proteinase A inhibitor IA3 0.017
Family Proteinase A inhibitor IA3 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G8ZWK9
Sequence length 58
Comment (tr|G8ZWK9|G8ZWK9_TORDC) Uncharacterized protein {ECO:0000313|EMBL:CCE93003.1} KW=Complete proteome; Reference proteome OX=1076872 OS=NCYC 2629 / NRRL Y-866) (Yeast) (Candida colliculosa). GN=TDEL_0F01920 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Torulaspora.
Sequence
MSDFFQQAKDKLTGDTNVANEHLKKLADKYPVNTEEQEQARARNEQAYQSLKQHKQQK
Download sequence
Identical sequences G8ZWK9
XP_003682214.1.64532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]