SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0AAB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0AAB9
Domain Number 1 Region: 2-136
Classification Level Classification E-value
Superfamily MTH1598-like 9.68e-24
Family MTH1598-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0AAB9
Sequence length 136
Comment (tr|H0AAB9|H0AAB9_HALSG) Uncharacterized protein {ECO:0000313|EMBL:EHK02261.1} KW=Complete proteome; Reference proteome OX=1072681 OS=Haloredivivus sp. (strain G17). GN=HRED_01831 OC=Candidatus Haloredivivus.
Sequence
MFEILEHSADEKFYAEGESKEEAFSEAVKAFAEIVGGNTEGMYHQKIEVESENLEALLYD
FLEELVFLQDSEGVAISHAEDVKIEEKTDSWKINASILVDNITSDMNLLDIKSPTYNEMK
VDYQDEKWILEAVLDV
Download sequence
Identical sequences H0AAB9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]