SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0VBG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0VBG2
Domain Number 1 Region: 53-104
Classification Level Classification E-value
Superfamily GLA-domain 4.54e-20
Family GLA-domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0VBG2
Sequence length 198
Comment (tr|H0VBG2|H0VBG2_CAVPO) Proline rich and Gla domain 2 {ECO:0000313|Ensembl:ENSCPOP00000007243} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=PRRG2 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MRGHPSLLLLYMGLATCLDSSPSGEQDQGPEVFLGPSEAQGFLKGHRRVPRANHWDLELF
TPGNLERECYEEQCSWEEARECFEDNTQTNTFWETYLYNGKGGQRRVDGAALAVGLTSGI
MLIILAALGAFWYLHYRQRQTSSQQLSPQETNLISPLNPPTPLAAPRPPGLPTYEQALAA
SGVHDAPPPPYSSLRRPQ
Download sequence
Identical sequences H0VBG2
XP_003465556.2.53824 XP_013003359.1.53824 XP_013003360.1.53824 ENSCPOP00000007243 ENSCPOP00000007243 10141.ENSCPOP00000007243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]