SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YHQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H0YHQ4
Domain Number - Region: 88-134
Classification Level Classification E-value
Superfamily Moesin tail domain 0.000314
Family Moesin tail domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0YHQ4
Sequence length 191
Comment (tr|H0YHQ4|H0YHQ4_HUMAN) MORC family CW-type zinc finger protein 3 {ECO:0000313|Ensembl:ENSP00000447562} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MORC3 OC=Catarrhini; Hominidae; Homo.
Sequence
ETDAVFLLESINGKSESPDHMVSQYQQALEEIERLKKQCSALQHVKAECSQCSNNESKSE
MDEMAVQLDDVFRQLDKCSIERDQYKSEVELLEMEKSQIRSQCEELKTEVEQLKSTNQQT
ATDVSTSSNIEESVNHMDGESLKLRSLRVNVGQLLAMIVPDLDLQQVNYDVDVVDEILGQ
VVEQMSEISST
Download sequence
Identical sequences A0A2J8M7M5 H0YHQ4
ENSP00000447562 ENSP00000448357 ENSP00000449467 ENSP00000447562 ENSP00000448357 ENSP00000449467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]