SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YQU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YQU9
Domain Number 1 Region: 21-336
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.8e-81
Family Glycosyl hydrolases family 35 catalytic domain 0.00021
Further Details:      
 
Domain Number 2 Region: 457-587
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.71e-25
Family Beta-galactosidase LacA, domains 4 and 5 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0YQU9
Sequence length 587
Comment (tr|H0YQU9|H0YQU9_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000000656} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
RFNWSELTPLGLWGRTLGLQTENSQFLLEGMPFRIFGGSMHYFRVPREYWEDRMLKMRAC
GLNTLTTYVPWNLHEKERGKFDFSKNLDLRAFLSLAAKTGWVILRPGPYICSEWDLGGLP
SWLLQDPEMQLRTTYKGFTEAVDAYFDRLMRVVHELQFYKKGGPIIAVQVENEYGSYAKD
PNYMTYVKMALLNRGIVELLMTSDNKNGLSFGLVEGVYRFPHCKQCHENCAWGFYFLHEA
IPELLYVFKASGLQHRGALHSRGTGQGMVNTVASILKTGASINLYMFHGGTNFGFMSGAL
EADEYKSDVTSYDYDAVLTEAGDYTSKFFKLRQLFSMVIGQPLPLPPMIESKASYGAILL
HQYISLWDVLPALLQPIKSEFPVNMENLPLNASVGQPYGYVLYETVIFGGGHLHTRDHVR
DRAQVFVNTVYVGELDYNTVELSIPEGQQGFRQLRILVENRGRVNYGLALNEQRKGLIGD
VFLNKTPLRNFKIYSLEMKPSFMKRFHVSGWSTVPDYFVGPAFFRGRLWIEQQPQDTFLK
LQASPKGVVFVNGQNLGRYWKIGPQETLYLPGPWLRRGGNEIVIFEE
Download sequence
Identical sequences H0YQU9
ENSTGUP00000000656 ENSTGUP00000000656 59729.ENSTGUP00000000656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]