SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YX36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YX36
Domain Number 1 Region: 426-736
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-75
Family Protein kinases, catalytic subunit 0.000000887
Further Details:      
 
Domain Number 2 Region: 2-49
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000213
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0YX36
Sequence length 744
Comment (tr|H0YX36|H0YX36_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000002862} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
QVIDGNTDTYDVVLKDLRPPIIARFVRLIPVTKAPMTVCMRVELYGCVWHGMGLASYSIP
EGGTIAAPGFPIVYLNDSTYDGYQERRHLYGGLGQLTDGVLGLDDFTQSHQYRVWPGYDY
VGWRNESFSTGAVEMEFQFDRPRNFTSMKVHCNNMFSKGVKIFQRVECLFKPRLIADWEP
EPVGVATVLDDKNPSARFVTVPLQQRVGKAILCRFYFADTWMMMSEISFQSDMESVNPSF
VTAATSTTELLETEHNVTEGTWGTTSSVTSTWIGEKADDSNTSILVGCLVAIILLLLMII
IIILWKQYVQKRLEKAPRRILEEDATVRLSFYSYTIANNQTQIHQSNPTYERAFPLDLEY
HQPATLLQKLPELSQSAEDSVCSGDYAEPDLTKSTPHQGFQNNVPHYAETDIVHLQGVTG
NNMYAVPALTVDSLTKKDISVGEFPRQQLRLKEKLGEGQFGEVHLCEADGLLEFLGVSSS
EFTHQPVLVAVKMLRSDVNKTARNDFLKEIKIMSRLKNPNIIRLLGVCVREDPLCMITEY
MENGDLNQFLSHREIYSKFAISNNIPCVTHSNLLYMATQIASGMKYLASLNFVHRDLATR
NCLVGNNYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMAWESILLGKFTTASDVWAFG
VTLWEMFVLCKEKPYSLLTGQQGIQNTGELIRQVGKVSIYLSQTPLCPNPVFDLMLKCWS
RDIKDRPTFDMIHQFLLEQMEANI
Download sequence
Identical sequences H0YX36
ENSTGUP00000002862 59729.ENSTGUP00000002862 ENSTGUP00000002862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]