SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H1A0K1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H1A0K1
Domain Number 1 Region: 110-258
Classification Level Classification E-value
Superfamily FAS1 domain 3.79e-26
Family FAS1 domain 0.0026
Further Details:      
 
Domain Number 2 Region: 48-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000093
Family Merozoite surface protein 1 (MSP-1) 0.098
Further Details:      
 
Domain Number 3 Region: 1-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family EGF-like domain of nidogen-1 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H1A0K1
Sequence length 258
Comment (tr|H1A0K1|H1A0K1_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000016410} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
CSAIDACESSNGGCSSKAECRRTTPGNRACVCSAGYTGDGIVCIEINPCLMNNGGCDRNA
ECTQTGPNQAVCNCLKGYSGDGKTCTYISLCSQNNGGCSEFAICNDTELTERTCTCKPNY
IGDGFKCRGNIFQELLRNSNTSRFYFHLEALSIRDISGPGPFTLFVPHTDVLNSDPRVKD
WVAKGVMAQVLRYHVVGCASLLYKDLAAITNVTSLQGDLIHISYSQNSLVLNNKAEIVLS
DAVGTNGVIHVINQILVP
Download sequence
Identical sequences H1A0K1
59729.ENSTGUP00000016410 ENSTGUP00000016410 ENSTGUP00000016410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]