SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H1Q2E1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H1Q2E1
Domain Number - Region: 77-129
Classification Level Classification E-value
Superfamily YfbU-like 0.0196
Family YfbU-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H1Q2E1
Sequence length 154
Comment (tr|H1Q2E1|H1Q2E1_9BACT) Uncharacterized protein {ECO:0000313|EMBL:EHO70798.1} KW=Complete proteome; Reference proteome OX=883158 OS=Prevotella micans F0438. GN=HMPREF9140_01079 OC=Prevotella.
Sequence
MRSRTSMWFETRVRYDKTMEDGSNKKVTETYTVDALSFSEAENFITEEMSHYITGDFEVK
GITPAAYGEIFFSDADTDDNWFKTRLSFITIDEKSEQEKRSYVTYLVQAHSVNGAMKHIE
EVMNSTMIDYEIVAISETKIMDVFEHKNKSKENE
Download sequence
Identical sequences H1Q2E1
WP_006952349.1.36050 WP_006952349.1.42176 WP_006952349.1.51961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]