SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2D450 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2D450
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 7.59e-33
Family Variable surface antigen VlsE 0.0000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2D450
Sequence length 134
Comment (tr|H2D450|H2D450_BORBN) Variable large protein {ECO:0000256|RuleBase:RU363105} OX=521007 OS=Borrelia burgdorferi (strain N40). GN= OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borreliella.
Sequence
GKKEDVLKDVQAAGDADAETGKLFGGGVAGGDAGAADIKKAAKAVSSVSGEQILKAIVAA
AGGGEQVGAAPGAAKNPIAAAIGAAGGGANFDADMQKKDKVAAALVLRGLAKDGKFSATN
ANDANVKSAVENVV
Download sequence
Identical sequences H2D450 H2D491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]