SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2D465 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2D465
Domain Number 1 Region: 2-137
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 1.31e-33
Family Variable surface antigen VlsE 0.0000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2D465
Sequence length 137
Comment (tr|H2D465|H2D465_BORBG) Variable large protein {ECO:0000256|RuleBase:RU363105} OX=139 OS=burgdorferi). GN= OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borreliella.
Sequence
GKKEDVLKDVQAAGDADQETGKLFGTAAGGNDAGAADIKKAAKAVSSVSGEQILKAIVDA
AGKEDEQDGAAPGAAKNPIAAAIGNGAGDAGANFDADMKKKDKVAAALVLRGLAKDGKFS
VTNANDANVKSAVENAV
Download sequence
Identical sequences H2D449 H2D465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]