SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2JWZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JWZ4
Domain Number 1 Region: 12-308
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.82e-60
Family Protein kinases, catalytic subunit 0.0000923
Further Details:      
 
Domain Number 2 Region: 526-799
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.85e-25
Family Quinoprotein alcohol dehydrogenase-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2JWZ4
Sequence length 849
Comment (tr|H2JWZ4|H2JWZ4_STRHJ) Putative serine/threonine protein kinase {ECO:0000313|EMBL:AEY88897.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_3625 OC=Streptomyces.
Sequence
MQPLRATDPRHIGPYATTHRLGAGGMGEVYLAESRTGLRLAVKVVRAEHAEDRTFRARFR
HEVRAAQTVGGADTYTARVVDADTDAERPWMATEFVSGPNLRDAILDHGALPRPAVRILA
AALGEALAAIHAKGLVHRDLKPSNILLGPDGPRVIDFGIVRALEATALTRTGAVVGSVGY
VSPEQIRNGGQVGPPSDVFSLGAVLAYAAAGREPFGEGQDSVVLLRILTRDFDLSGVPDD
IRPLVTACLREDPLERPEPAEVVASAGFAPDTLRAAVRPGWYGPASRPRPAPDDRPSGVE
YLAPHPTATPADATTRATWTDPATPVALEGSAIPAGHGDSAVSATPRGSVAHADPADSAA
RAARTDVTDRATPADSAAPVTLEGSAIPAGHGGSAVSATPSGSVAHADPADSAARAARTD
PAGSAAPAAPLGPAAPAAPDGSADPGTPGGSAGAVTSVDSDAPGRRLGAVAPGRRRLLKA
LGGGAVAVAGVGVGGWLWEYGLRTESSGGSDSSSVPSADRTNGAAVLRWQYDLGGIGGLD
GACCALSPDGSVVYAGTSGGVLHAISRDGSKRWKVRLGDDVSTPVATRDAVYCVVGLHSE
DARRLTAVSPSGSPLWTRTLGDQRYDVPVLLGQDVLVSVGGTTTGGLRCYASDGGEKWTA
KTLAGPTGTPIVSGGTVFTGSYGDVLLALDARDGSRKWEVSGGTDVTALVLAGTTLFADS
AAELRGFRVTDGRRLWRREDDGGILTGGSRTLAVGTEQGGVYAVRAADGSRAWRYGFEGG
RAYPRAVLSGDTVYARAGEKVCALDLNGKRRWNAVLGRDAGDDQHTPVARGGRLYVPSGT
GIAAVDVRA
Download sequence
Identical sequences H2JWZ4
gi|474981923|ref|YP_007692389.1| gi|386839712|ref|YP_006244770.1| WP_014672229.1.21199 WP_014672229.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]