SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LMW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LMW2
Domain Number 1 Region: 18-137
Classification Level Classification E-value
Superfamily ISP domain 3.27e-20
Family Ring hydroxylating alpha subunit ISP domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2LMW2
Sequence length 162
Comment (tr|H2LMW2|H2LMW2_ORYLA) Rieske Fe-S domain containing {ECO:0000313|Ensembl:ENSORLP00000007385} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=RFESD OC=Oryziinae; Oryzias.
Sequence
LGRLSSLSDSPCSSPPNLHYVGKKEEIVKAGRLTKLLNGCRDVLILYHDRQLYAMDKRCY
HSGGELQHGDIEEFNGRLCIVCPWHSYKITLAEGEGLYQAVDDPTKKPPRTHWRSKGVKQ
RIHKVTEINGDVFVTLNKSCEAIESDFYQTEKYRPVTLKGQP
Download sequence
Identical sequences H2LMW2
ENSORLP00000007385 ENSORLP00000007385 8090.ENSORLP00000007385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]