SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2ML22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2ML22
Domain Number 1 Region: 921-995
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000984
Family Homeodomain 0.016
Further Details:      
 
Weak hits

Sequence:  H2ML22
Domain Number - Region: 1066-1100
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000277
Family Classic zinc finger, C2H2 0.06
Further Details:      
 
Domain Number - Region: 280-304,388-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00174
Family Classic zinc finger, C2H2 0.043
Further Details:      
 
Domain Number - Region: 216-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.058
Family Classic zinc finger, C2H2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2ML22
Sequence length 1117
Comment (tr|H2ML22|H2ML22_ORYLA) Teashirt zinc finger homeobox 3b {ECO:0000313|Ensembl:ENSORLP00000019393} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
IDRQEPLSPRLIQAAYVPEDEKEAALLDEERDGEDSAQEGEEATVKNFLFKDRPGSTGIH
DSPNAADFSGQEMDSESHLSESSDRMSDFDSSSIKNEEDSGDEAMIPATGSVADSLEKMK
AIYTSFLTNSYWSTLNLNMSQPPAEKLPRSCGSGGYDWHQTAMAKTLQQASQNHHNRLSM
AQHPTVAVSTASTEPNLFSTVQLYRQSSKLYGSIFTGASKFRCKDCSAAYDTLVELTVHM
NETGHYRDDNHETDSEGTKRWSKPRKRSLLEMEGKEDAQKVLKCMYCGHSFESLQDLSVH
MIKTKHYQKVPLKEPVTPVAAKIISSARKRVPIDLDIPSSPDSTGGTTPKPISLNDDILQ
KINNPYITPNNRYGHQNGASYAWQFESRKSQILKCMECGSSHDTLQELTAHMMVTGHFIK
VTNSAIKKGKPVIESSPQAPMSNSTTEEKVQSVPLAATTFSPPPAPVPPPTSLSPTAMVV
EIKKEEKEEGCTEEPIINNTLKDKREGGEEDTEEKFDISSKYTYLTEEDLDESPKGGLDI
LKSLENTVTSAINKAQNGAPSWGGYPSIHAAYQLPNIMKLSLGNSGKSSPLKYMFPGAEI
LSPTGKSQALLSPPSRQTSPLPKNNFHAMEELVKKVTEKAVKVEEKTREASAAVKDLPQR
HATPSPCNSETENAAQANKGSGGGQGKDGNDGTDHRDSNGSITMKEPVENGVESPAITSP
LPATLGSSTTIITDHPPPEQPFVNPLSALQSVMNVHLGKAAKPALPSLDPMSMLFKMSNS
LAEKAAVASSTPPAHAKKTNNDHLDHYFYQQHISNDQPIDLTKGKVADKSSNGGSLGSTA
LSSTTSTPSVSPSSAVAMTKASAAVASFMSTSPLRENALSDISDMLRNLTESQATSKSST
PTSQCERSDIEGATQEETEDISPAQKRKGRQSNWNPQHLLILQAQFASSLRQTNDGKYMM
SDLSPQERMHISRFTGLSMTTISHWLANVKYQLRRTGGTKFLKNLDSGHPVFFCSDCASQ
IRSPSTYVSHLESHLGFRLRDLAKLSAISMTSSLTTSLASTKSPPPSPEDDDSGAIYQCK
LCNRTFASKHAVKLHLSKTHGKSPEDHLMYVCELDKQ
Download sequence
Identical sequences H2ML22
ENSORLP00000019393 ENSORLP00000019393 8090.ENSORLP00000019393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]