SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2N6V5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2N6V5
Domain Number - Region: 31-73
Classification Level Classification E-value
Superfamily SRCR-like 0.0602
Family Scavenger receptor cysteine-rich (SRCR) domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2N6V5
Sequence length 95
Comment (tr|H2N6V5|H2N6V5_PONAB) Uncharacterized protein {ECO:0000313|Ensembl:ENSPPYP00000001372} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN= OC=Catarrhini; Hominidae; Pongo.
Sequence
MVAMAAGPSGCLVPAFGLRLLLATVLQAVSAFGAEFSSEACRELGFSSNLLCSSCDLLGQ
FNLLQLDPDCRGCCQEEAQFETKKLYAGAILEVCG
Download sequence
Identical sequences D3DT21 H2N6V5
ENSPPYP00000001372 ENSPPYP00000001372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]