SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NBW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NBW5
Domain Number 1 Region: 314-643
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.62e-71
Family Pancreatic carboxypeptidases 0.00000196
Further Details:      
 
Domain Number 2 Region: 136-296
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.73e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00015
Further Details:      
 
Domain Number 3 Region: 643-731
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.86e-19
Family Carboxypeptidase regulatory domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2NBW5
Sequence length 756
Comment (tr|H2NBW5|H2NBW5_PONAB) Carboxypeptidase X, M14 family member 2 {ECO:0000313|Ensembl:ENSPPYP00000003196} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CPXM2 OC=Catarrhini; Hominidae; Pongo.
Sequence
MSRPGTATPALALVLLAVTLAGVGAQGAALEDPDYYGQEIWSREPYYARPEPEPETFSPP
LPAGPGEEWERRPQEPRPPKRATKPKKAPKREKSAPEPPPPGKHSNKKVMRTKSSEKAAN
DDHNIRVAHEDFRESCPPLGLETLKITDFQLHASTVKRYGLGAHRGRLNIQAGINENDFY
DGAWCAGRNDLQQWIEVDARRLTRFTGVITQGRNSLWLSDWVTSYKVLVSNDSHTWVTVK
NGSGDMIFEGNSEKEIPVLNELPVPMVARYIRINPQSWFDNGSICMRMEILGCPLPDPNN
YYHRRNEMTTTDDLDFKHHNYKEMRQLMKVVNEMCPNITRIYNIGKSHQGLKLYAVEISD
HPGEHEVGEPEFHYIAGAHGNEVLGRELLLLLVQFLCQEYLAGNARIVHLVEETRIHILP
SLNPDGYEKAYEGGSELGGWSLGRWTHDGIDINNNFPDLNTLLWEAEDRQNVPRKVPNHY
IAIPEWFLSENATVAAETRAVIAWMEKIPFVLGGNLQGGELVVAYPYDLVRSPWKTQEHT
PTPDDHVFRWLAYSYASTHRLMTDARRRVCHTEDFQKEEGTVNGASWHTVAGSLNDFSYL
HTNCFELSIYVGCDKYPHESQLPEEWENNRESLIVFMEQVHRGIKGLVRDSHGKGIPNAI
ISVEGINHDIRTANDGDYWRLLNPGEYAVTAKAEGFTASTKNCMVGYDMGATWCDFTLSK
TNMARIREIMEKFGKQPVSLPARRLKLQGRKRRQRG
Download sequence
Identical sequences H2NBW5
ENSPPYP00000003196 9600.ENSPPYP00000003196 XP_002821282.1.23681 ENSPPYP00000003196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]