SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NXZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NXZ7
Domain Number 1 Region: 54-124
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-28
Family Nuclear receptor 0.0001
Further Details:      
 
Domain Number 2 Region: 96-201
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-23
Family Nuclear receptor ligand-binding domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2NXZ7
Sequence length 215
Comment (tr|H2NXZ7|H2NXZ7_PONAB) Uncharacterized protein {ECO:0000313|Ensembl:ENSPPYP00000010873} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN= OC=Catarrhini; Hominidae; Pongo.
Sequence
MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCG
DKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVG
MRKEDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLIS
QLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ
Download sequence
Identical sequences H2NXZ7
ENSPPYP00000010873 9600.ENSPPYP00000010873 ENSPPYP00000010873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]