SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PBB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PBB4
Domain Number 1 Region: 170-431
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.49e-90
Family Transglutaminase core 0.000000000318
Further Details:      
 
Domain Number 2 Region: 469-636
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.51e-59
Family Extended PAW domain 0.000000118
Further Details:      
 
Domain Number 3 Region: 15-116
Classification Level Classification E-value
Superfamily PUG domain-like 1.09e-31
Family PUG domain 0.0000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2PBB4
Sequence length 637
Comment (tr|H2PBB4|H2PBB4_PONAB) N-glycanase 1 {ECO:0000313|Ensembl:ENSPPYP00000015731} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=NGLY1 OC=Catarrhini; Hominidae; Pongo.
Sequence
MAAAALGSSSGSESPAVAELCQNTPETFLEASKLLLTYADNILRNPNDEKYRSIRIGNTA
FSTRLLPVRGAVECLFEMGFEEGETHLIFPKKASVEQLQKIRDLIAIERSSRLDGSNKSH
KVKSSQQPAASTQLPTTPSSNPSGLNQHTRNHQGQSSDPPSASTQHVLVYENALQEKALA
CIPVQLKRESPQEKFLRARKLDKGTNISDEDFLLLELLHWFKEEFFQWVNNILCSKCGGQ
TRSRDRSLLPNDDELKWGAKKVEDHYCDACQFSNRFPRYNNPEKLLETRCGRCGEWANCF
TLCCRALGFEARYVWDYTDHVWTEVYSPSQQRWLHCDACEDVCDKPLLYEIGWGKKLSYV
IAFSKDEVVDVTWRYSCKHEEVIARRTKVKEALLRETINGLNKQRQLFLSENRRKELLQR
IIVELVEFISPKTPKPGELGGRISGSVAWRVARGEMGLQRKETSFIPCNDKISKQLHLCY
NIVKDCYVRVSNNNETISGWENGVWKMESIFRKVETDWHMVYLARKEGSSFAYISWKFEC
GSVGLKVDSISIRTSSQTFQTGTIEWKLRSDTARVELTGDNSLHSYADFSGATEVILEAE
LSRGDGDVAWQHTQLFRQSLNDHEEDCLEIIIKFSDL
Download sequence
Identical sequences H2PBB4
9600.ENSPPYP00000015731 ENSPPYP00000015731 ENSPPYP00000015731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]