SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PJ48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PJ48
Domain Number 1 Region: 1474-1578,1612-1754
Classification Level Classification E-value
Superfamily Cullin homology domain 2.22e-40
Family Cullin homology domain 0.00098
Further Details:      
 
Domain Number 2 Region: 1073-1229
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.49e-36
Family APC10-like 0.0057
Further Details:      
 
Domain Number 3 Region: 366-440
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.62e-32
Family CPH domain 0.000014
Further Details:      
 
Domain Number 4 Region: 2158-2211
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000671
Family RING finger domain, C3HC4 0.0042
Further Details:      
 
Domain Number 5 Region: 1999-2084
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000177
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 6 Region: 141-198,507-541,631-714,917-1008
Classification Level Classification E-value
Superfamily ARM repeat 0.000000605
Family RPA1889-like 0.063
Further Details:      
 
Weak hits

Sequence:  H2PJ48
Domain Number - Region: 1785-1883
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00245
Family SCF ubiquitin ligase complex WHB domain 0.057
Further Details:      
 
Domain Number - Region: 2071-2139
Classification Level Classification E-value
Superfamily RING/U-box 0.00388
Family IBR domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2PJ48
Sequence length 2448
Comment (tr|H2PJ48|H2PJ48_PONAB) Cullin 9 {ECO:0000313|Ensembl:ENSPPYP00000018607} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CUL9 OC=Catarrhini; Hominidae; Pongo.
Sequence
MVGEWHAGDLMVPLGPRLQAYPEELIRQRPGHDGHPEYLIRWSVLKCGEEGKVGVEEGKA
EHILMWLSAPEVYANCPGLLGERALSKGPQHEPAGVSGSFPRDPGGLDEVAMGEMEADVQ
ALVRRAARQLAESGTPSLTAAVLHTIHVLSAYASIGPLTGVFRETGALDLLMHMLCNPEP
QIRRSAGKMLQALAAHDAGSRAHVLLSLSQQDGIEQHMDFDSRYTLLELFAETTSSEEHC
MAFEGIHLPQIPGKLLFSLVKRYLCVTSLLDQLNSSPELGAGDQSSPCATREKSRGQREL
EFSMAVGNLISELVRSMGWARNLSEQGMSPPRPTRSIFQPYISGPSLLRPTIVTTPRRQG
WVFRQRSEFSSRSGYGEYVQQTLQPGMRVRMLDDYEEISAGDEGEFRQSNNGIPPVQVFW
QSTGRTYWVHWHMLEILGPEEATEDKASAAVEKGAGATVLGTAFPSWDWNPVDGLYPLPY
LQPEPQKNERVGYLTQAEWWELLFFIKKLDLCEQQPIFQNIWKNLDETLGEKALGEISVS
VEMAESLLQVLSSRFEGSTLNDLLNSQIYTKYGLLSNEPSSSFTSRNHSCTPDPEEESKS
EASVSEEETESPKAKAEAPKTEAEPTKTRTEPPMAQSDSQLFNQLLVTEGMTLPTEMKEA
ASEMARALRGPGPRSSLDQHVAAVVATVQISSLDTNLQLSGLSALSQAVEEVTERDHPLV
HPDRSLALKMLAVATSSEIPTFVTGRDSIHSLFDAQMTREIFASIDSATRPGSESLLLTV
PAAVILMLNTEGCSSAARNGLLLLNLLLCNHHTLGDQIITRELRDTLFRHSGIAPGTEPM
PTTRTILMMLLNRYSEPPGSPECAALETPIIQGQDGSPELLIRSLVGGPSAELLLDLERV
LCHEGSPGGAVRPLLKRLQQETQPFLLLLRTLDAPGPNKTLLLSVLRVITRLLDFPETMV
LPWHEVLEPCLNCLSGPSSDSEIVQELTCFLHRLASMHKDYAVVLCCLGAKEILSKVLDK
HSAQLLLGCELRDLVTECEKYAQLYSNLTSSILAGCIQMVLGQIEDHRRTHQPINIPFFD
VFLRHLCQGSSVEVKEDKCWEKVEVSSNPHRASKLTDHNPKTYWESNGSTGSHYITLHMH
RGVLVRQLTLLVASEDSSYMPARVVVFGGDSTSCISTELNTVNVMPSASRVILLENLNRF
WPIIQIRIKRCQQGGIDTRVRGVEVLGPKPTFWPLFREQLCRRTCLFYTIRAQAWSRDIA
EDRRRLLQLCPRLNRVLRHEQNFADRFLPDDEAAQALGKTCWEALVSPLVQNITSPDAEG
VSALGWLLDQYLEQRETSRNPLSRAASFASRVRRLCHLLVHVEPPPGPSPEPSTRPFSKN
SKGRDRSPAPSPVLPSSSLRNITQCWLSVVQEQVGRFLAAAWRAPDFVPRYCKLYEHLQR
AGSELFGPRAAFTLALRSGFSGALLQQSFLTAAHMSEQFARYIDQQIQGGLIGGAPGVEM
LGQLQRHLEPIMVLSGLELATTFEHFYQHYMADRLLSFGSSWLEGAVLEQIGLCFPNRLP
QLMLQSLSTSEELQRQFHLFQLQRLDKLFLEQEDEEEKRLEEEEEEEEEEEAEKELFIED
PSPAISILVLSPRCWPVSPLCYLRHPRKCLPTEFCDALGRFSSFYSHSQNHPVLDMGPHR
RLQWTWLGRAELQFGNQTLHVSTVQMWLLLKFNQTEEVSVETLLKDSDLSPELLLQALVP
LTSGNGPLTLHEGQDFPHRGVLQLHEPGPQRSGEALWLIPSQAYLNVEKDEGRTLEQKRN
LLSCLLVRILKAHGEKGLHIDQLVCLVLEAWQKGPNPPGTLGHTVAGGVACTSTDVLSCI
LHLLGQGYVKRRDDRPQILMYAAPEPMGPCRGQADVPFCGSQSKTSKPSPEAVATLASLQ
LPAGRTMSPQEVEGLMKQTVCQVQETLNLEPDVAQHLLAHSHWGAEQLLQSYSEDPEPLL
LAAGLCVPQAQAVPARPDHCPVCVSPLGCDDDLPSLCCMHYCCKSCWNEYLTTRIEQNLV
LNCTCPIADCPAQPTGAFIRAIVSSPEVISKYEKALLRGYVESCSNLTWCTNPQGCDRIL
CRQGLGCGTTCSKCGWASCFNCSFPEAHYPASCGHMSQWVDDGGYYDGMSVEAQSKHLAK
LISKRCPSCQAPIEKNEGCLHMTCAKCNHGFCWRCLKSWKPNHKDYYNCSAMVSKAARQE
KRFQDYNERCTFHHQAREFAVNLRNRVSAIHEVPPPRSFTFLNDACQGLEQARKVVLAYA
CVYSFYSQDAEYMDVVEQQTENLELHTNALQILLEETLLRCRDLASSLRLLRADCLSTGI
ELLRRIQERLLAILQHSAQDFRVGLQSPSVEAWEAKGPNMPGSQPQASSGPEVEEEEEDD
EDDVPEWQQDEFDEELDNDSFSYDESENLDQETFFFGDEEEDEDEAYD
Download sequence
Identical sequences H2PJ48
9600.ENSPPYP00000018607 ENSPPYP00000018607 ENSPPYP00000018607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]