SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PMQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2PMQ9
Domain Number 1 Region: 109-183
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.14e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2PMQ9
Sequence length 203
Comment (tr|H2PMQ9|H2PMQ9_PONAB) Twist family bHLH transcription factor 1 {ECO:0000313|Ensembl:ENSPPYP00000019900} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0019615 OC=Catarrhini; Hominidae; Pongo.
Sequence
MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAASGGV
GGGDEPGSPAQGKRGKKSAGCGGGGGGGAGGGGSSSGGGSPQSYEELQTQRVMANVRERQ
RTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVA
HERLSYAFSVWRMEGAWSMSASH
Download sequence
Identical sequences H2PMQ9
XP_002818224.1.23681 ENSPPYP00000019900 9600.ENSPPYP00000019900 ENSPPYP00000019900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]