SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2PUF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2PUF8
Domain Number - Region: 595-659
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0523
Family HLH, helix-loop-helix DNA-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2PUF8
Sequence length 892
Comment (tr|H2PUF8|H2PUF8_PONAB) Uncharacterized protein {ECO:0000313|Ensembl:ENSPPYP00000022344} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN= OC=Catarrhini; Hominidae; Pongo.
Sequence
MAGGVTVTNGVKGKKSTCPSAAPSASAPAMTTVENKSKISTGTASSTKRSTSTGQGANDM
ALAKRSHSRTATECDVRMSKSKSDNQITDRAALEAKVKDLLTLAKTKDVEILHLRNELRD
MRAQLGINEDHSEGDEKSEKETIMAHQPTDVESTLLQLQEQNTAIREELNQLKNENRMLK
DRLNALGFSLEQRLDNSEKLFGYQSLSPEITPGNQSDGGGTLTSSVEGSAPGSVEDLLSQ
DENTLMDHQHSNSMDNLDSECSEVYQPLTSSDDALDAPSSSESEGIPSIERSRKGSSGNA
SEVSVACLTERIHQMEENQHSTSEELQATLQELADLQQITQELNSENERLGEEKVILMES
LCQQSDKLEHFSRQIEYFRSLLDEHHISYVIDEDVKSGRYMELEQRYMDLAENARCEREQ
LLGVQQHLSNTLKMAEQDNKEAQEMIGALKERSHHMERIIESEQKEKAALAATLEEYKAT
VASDQIEMNRLKAQLENEKQKVAELYSIHNSGDKSDIQDLLESVRLDKEKAETLASSLQE
DLAHTPNDASRLQDAIAKVEDEYRAFQEEAKKQIEDLNMTLEKLRSDLDEKETERSDMKE
TIFELEDEVEQHRAVKLHDNLIISDLENTVKKLQDQKHDMEREIKTLHRRLREESVEWRQ
FQADLQTAVVIANDIKSKAQEEIGDLKRWLHEAQEKNEKLTKELEEIKSRKQEEERGWVY
NYMNAVERDLAALRQGMGLSRRSSTSSEPTPTVKTFIKSFDSASQVPNPAAAAIPRTPLS
PSPMKTPPAAAVSPMQVLRVAEMLRWRGGQAPHCLAGAPREERPEVSSKCHQQSEVQFLR
LSSWGAVQPVQILFQPLFLTSCLLSVCSRNETWCTLYLLGSPGFRAGHHCYP
Download sequence
Identical sequences H2PUF8
ENSPPYP00000022344 ENSPPYP00000022344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]