SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Q0U3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Q0U3
Domain Number 1 Region: 581-660
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.89e-21
Family Complement control module/SCR domain 0.0051
Further Details:      
 
Domain Number 2 Region: 453-533
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.37e-20
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Domain Number 3 Region: 206-268
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000017
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 333-389
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000013
Family Complement control module/SCR domain 0.00058
Further Details:      
 
Domain Number 5 Region: 396-455
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000288
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 6 Region: 273-327
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000747
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 7 Region: 522-578
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000032
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 8 Region: 154-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000826
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 9 Region: 91-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000446
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 10 Region: 25-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000354
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2Q0U3
Sequence length 661
Comment (tr|H2Q0U3|H2Q0U3_PANTR) F13B isoform 1 {ECO:0000313|EMBL:PNI34671.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0038784 OC=Catarrhini; Hominidae; Pan.
Sequence
MRLKNLTFIIILIISGELYAEEKPCGFPHVENGRIAQYYYTFKSFYFPMSIDKKLSFFCL
AGYTTESGRQEEQTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMRYGCAS
GYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYEC
TTGYYTAGGKKTEEVECLTYGWSLTPKCTKLKCSSLRLIENGYFHPVKQTYEEGDVVQFF
CHENYYLSGSDLIQCYNFGWYPESPVCEGRRNRCPPPPLPINSKIQTHSTTYRHGEIVHI
ECELNFEIHGSAEIRCEDGKWTEPPKCIEGQEKVACEEPPFIENGAANLHSKIYYNGDKV
TYACKSGYLLHGSNEITCNRGKWTLPPECVENNENCKHPPVVMNGAVADGLLASYATGSS
VEYRCNEYYLLRGSKISRCEQGKWSSPPVCLEPCTVNVDYMNRNNIEMKWKYEGKVLHGD
LIDFVCKQGYDLSPLTPLSELSVQCNRGEVKYPLCTRKESKGMCTSPPLIKHGVIISSTV
DTYENGSSVEYRCFDHHFLEGSREAYCLEGMWTTPPLCLEPCTLSFTEMEKNNLLLKWDF
DNRPHILHGEYIEFICRGDTYPAELYITGSILRMQCDRGQLKYPRCIPRQSTLSYQEPLR
T
Download sequence
Identical sequences H2Q0U3
XP_001137074.1.37143 9598.ENSPTRP00000003013 ENSPTRP00000003013 ENSPTRP00000003013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]