SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QDW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QDW6
Domain Number 1 Region: 424-580
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-26
Family SPRY domain 0.012
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily RING/U-box 8.39e-17
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 3 Region: 174-237
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000013
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2QDW6
Sequence length 642
Comment (tr|H2QDW6|H2QDW6_PANTR) Tripartite motif containing 47 {ECO:0000313|EMBL:JAA02677.1, ECO:0000313|Ensembl:ENSPTRP00000016415} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0039869 OC=Catarrhini; Hominidae; Pan.
Sequence
MDGSGPFSCPICLEPLREPVTLPCGHNFCLACLGALWPHRGASGAGGPGGAARCPLCQEP
FPDGLQLRKNHTLSELLQLRQGSGPGPGPGPAPALAPEPSAPSAPPSAPPSAPEPSAPCA
PEPWPAGEEPVRCDACLEGAALPAALSCLSCLASFCPAHLGPHERSPALRGHRLVPPLRR
LEESLCPRHLRPLERYCRAERVCLCEACAAQEHRGHELVPLEQERALQEAEQSKVLSAVE
DRMDELGAGIAQSRRTVALIKSAAVAERERVSRLFADAAATLQGFQTQVLGFIEEGEAAM
LGRSQGDLRRQEEQRSRLSRARQNLSQVPEADSVSFLQELLALRLALEDGCGPGPGPPRE
LSFTKSSQAVRAVRDMLAVACVNQWEQLRGPGGNEDGPQKLDSEADAEPQDLESTNLLES
EAPRDYFLKFAYIVDLDSDTADKFLQLFGTKGVKRVLCPINYPLSPTRFTHCEQVLGEGA
LDRGTYYWEVEIIEGWVSVGVMAEDFSPQEPYDRGRLGRNAHSCCLQWNGRSFSVWFHGL
EAPLPHPFSPTVGVCLEYADRALAFYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSR
LDSHFAGLFTHRLKPAFFLESVDAHLQIGPLKKSCISVLKRR
Download sequence
Identical sequences H2QDW6
XP_001147664.1.37143 ENSPTRP00000016415 ENSPTRP00000016415 9598.ENSPTRP00000016415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]