SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QU83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QU83
Domain Number 1 Region: 102-161
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.84e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2QU83
Sequence length 166
Comment (tr|H2QU83|H2QU83_PANTR) Fer3 like bHLH transcription factor {ECO:0000313|Ensembl:ENSPTRP00000032392} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0021351 OC=Catarrhini; Hominidae; Pan.
Sequence
MAAYPESCVDTTVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEG
DPEEEECEVDQGDGEEEEEEERGRGVSLLGRPKRKRVITYAQRQAANIRERKRMFNLNEA
FDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLESCEKKESG
Download sequence
Identical sequences G3S9M0 H2QU83 Q96RJ6
NP_690862.1.87134 NP_690862.1.92137 XP_004045190.1.27298 XP_009451009.1.37143 ENSP00000275461 9598.ENSPTRP00000032392 9606.ENSP00000275461 ENSPTRP00000032392 ENSPTRP00000032392 ENSGGOP00000024786 ENSGGOP00000024786 ENSP00000275461 gi|23097242|ref|NP_690862.1| ENSP00000275461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]