SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2S7L1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2S7L1
Domain Number 1 Region: 20-80
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000393
Family HLH, helix-loop-helix DNA-binding domain 0.0046
Further Details:      
 
Domain Number 2 Region: 89-120
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000497
Family Hairy Orange domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2S7L1
Sequence length 159
Comment (tr|H2S7L1|H2S7L1_TAKRU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000008383} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101067184 OC=Takifugu.
Sequence
MVSTSAAAMNKSQEQLTLTHKLRKPLVEKLRRERINSSIEQLKSLLGPEFFKQQPDSKME
KADVLEMTVCILRQMQQRNQARNSPAGEHGYSRCVKEVGQFLSRDQVQTQRRLMEHLTNL
QCSTHATLTEMDFSPAHCTPQTSVTKDRNPVKSSHWRPW
Download sequence
Identical sequences H2S7L1
XP_003973088.1.43653 ENSTRUP00000008383 ENSTRUP00000008383 31033.ENSTRUP00000008383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]