SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2SVE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2SVE0
Domain Number 1 Region: 11-76
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 85-129
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000106
Family Hairy Orange domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2SVE0
Sequence length 199
Comment (tr|H2SVE0|H2SVE0_TAKRU) Hairy-related 8.2 {ECO:0000313|Ensembl:ENSTRUP00000016378} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101074717 OC=Takifugu.
Sequence
NMTASSMEHSSGKHSRAKEERKMRKPLIERKRRERINNCLDQLKEAVIGAFQLDQSKLEK
ADILEMTVRHLQNIQSSKRGEVTSGLEAQQKYSTGYIQCVHEVHNMLLTCEWMDKTLGSR
LLNHLLKSLPRSADHCPPQSELQQDFLPHADQGTSVALSGESVARHLQRKRPPAHVADPS
QSPPPHGPQLGLLEMWRPW
Download sequence
Identical sequences H2SVE0
ENSTRUP00000016378 ENSTRUP00000016378 31033.ENSTRUP00000016378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]