SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2XXI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2XXI0
Domain Number - Region: 27-76
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.00745
Family N-terminal coiled coil domain from apc 0.0049
Further Details:      
 
Domain Number - Region: 59-141
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0759
Family Myosin rod fragments 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2XXI0
Sequence length 175
Comment (tr|H2XXI0|H2XXI0_CIOIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSCINP00000034364} KW=Complete proteome; Reference proteome OX=7719 OS=Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). GN= OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MKQLAESQRHLQEEKERTQTELQLVKAKADSMLNRVEELSQLSTTLRRELDDEKLTSSNL
QREVQSLQAIRSHDQDNLSRLEASLRESEVKVIRLQSDLTNSTRRESESKDDHEVLTRSR
MQMEQLIGRLQEEKGEAERKLQSQIITQFHIFCHFLLTLYSLLVTHGDLLSINLF
Download sequence
Identical sequences H2XXI0
ENSCINP00000034364 ENSCINP00000034364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]