SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3A1X9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3A1X9
Domain Number 1 Region: 152-346
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.00019
Further Details:      
 
Domain Number 2 Region: 23-143
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-31
Family Pleckstrin-homology domain (PH domain) 0.0000468
Further Details:      
 
Weak hits

Sequence:  H3A1X9
Domain Number - Region: 531-626
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00034
Family FCH domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3A1X9
Sequence length 636
Comment (tr|H3A1X9|H3A1X9_LATCH) Rho GTPase activating protein 25 {ECO:0000313|Ensembl:ENSLACP00000003650} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=ARHGAP25 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MIISQTTFVFLFLARSKSVMTGDPTGTSNRPASPSSLERPLKTGWLKKQRSIVKNWQHRY
FVLKGQQLLYYKDEEEGKPQGCIFLPGCQVQELASNPEEPGKFLFEIVPGISGDRDRIGQ
DTYVLMANSQNEMEEWVKSLRRVMGASSSGVVFGQRLADTVAYEQKYGQHLVPILVEKCA
EFIREHGLNEEGIFRLPGQDNQVKQLRDAFDAGERPSFDCETDVHTVASLFKLYLRELPE
PVIPWSQYEDFLSCAQLTNTDEEAGYQELVKQVALLPRVNYNLLSYICSFLYEIQLNSNV
NKMSVENLATVIGVNLLKPKIEDPVAIMRGTHQIQKLMTIMISNHEGLLPKSKDVPPSPP
SQKSDSKKAPIPRSSVGWDAAEDTSVSKKEEPNFSSLPCSGLKNSVENIDKISSDKLELW
AESPRKRTQTLPSRRPSIISNKAISDKLDIFSNEFWSSSPGAETNSASTNLSSASEGHKR
TLSQDFFKFLDTPRTSTYGNVLPSTTSPTLTDNKTGQSLKSSSPRTGSGGNETEEVSKEN
TSSLQNLVIELKREMEHQQNTYEQKIKSLEKDNYDIRAKVINLKKELEKEKKKNDALGIQ
LRNVQQAFEDAEKRNKALEKDIKDFIGSLNQSTTSD
Download sequence
Identical sequences H3A1X9
ENSLACP00000003650 ENSLACP00000003650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]