SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3A401 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3A401
Domain Number 1 Region: 135-276
Classification Level Classification E-value
Superfamily ISP domain 8.36e-38
Family Rieske iron-sulfur protein (ISP) 0.00000185
Further Details:      
 
Domain Number 2 Region: 82-150
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 1.13e-23
Family ISP transmembrane anchor 0.0000729
Further Details:      
 
Domain Number 3 Region: 1-55
Classification Level Classification E-value
Superfamily Non-globular alpha+beta subunits of globular proteins 1.31e-17
Family Ubiquinol-cytochrome c reductase 8 kDa protein 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3A401
Sequence length 277
Comment (tr|H3A401|H3A401_LATCH) Cytochrome b-c1 complex subunit Rieske, mitochondrial {ECO:0000256|RuleBase:RU004494} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=UQCRFS1 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MLSLAARSGAFAPYLSATAYPVASQLKPLAPGVVLRANDVLLDLKKSFLCRESLSWQAAR
TGLAATTSINETLICKISVRYAHSDISVPDFSDYRRADVLDSKKSSQESSDSRRGFSYLL
TGTTAIVTAYAAKAVVTQFVTSMSASADVLALSKIEIKLADIPEGKNMTFKWRGKPLFVR
HRSQKEIDHEAGVSLTELRDPQHDLDRVKKPEWMIVIGVCTHLGCVPIANAGEYGGYYCP
CHGSHYDASGRIRKGPAPYNLEVPYYEFHSDDLLVVG
Download sequence
Identical sequences H3A401
ENSLACP00000004372 ENSLACP00000004372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]