SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3A4Z8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H3A4Z8
Domain Number - Region: 178-226
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 0.0654
Family Tubulin chaperone cofactor A 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3A4Z8
Sequence length 259
Comment (tr|H3A4Z8|H3A4Z8_LATCH) Unconventional SNARE in the ER 1 {ECO:0000313|Ensembl:ENSLACP00000004719} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=USE1 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MAGTRLEVNFVRLLARCETLVAVKRDPTEWRLEKYVGALEEMLFAIKTHPSKPSPEVLSE
YARKVEFLQGLLKAEKLTSPTEKALANQFLTPGRTPTTSKERMSASKTVHLQTTARCTAE
MKNDLLNPGFSSLSGSDDANLRRRKSGMSNERQSGSDLDAVLQHHHNLQEKLAEEMLSLA
RNLKNNTLVTQNVIKQDNQTLSQSLRMADHNFEKLKTESDRLEQHAKKSVNWFLWLMLIV
VCFVFISMILFIRIFPKLK
Download sequence
Identical sequences H3A4Z8
ENSLACP00000004719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]