SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3AUV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H3AUV9
Domain Number - Region: 105-114
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0745
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3AUV9
Sequence length 278
Comment (tr|H3AUV9|H3AUV9_LATCH) Chromosome 21 open reading frame 58 {ECO:0000313|Ensembl:ENSLACP00000013430} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=C21orf58 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
TMADPALVDQMTRLKLKLLEKKIENERENMEDRSETAMSSARSYDGHEDALHSALRRRKD
LLQKLREQHVLEELARPHTWGGTRRKHHRLESIQQAPPINIYQPPPPPPPPEPPRIIQHT
MPQQPATIIQQLPQQQPLITQIPPLQALPPIRSGSIKEDMVELMLMQNAQMHQIIMHNMM
LKALPPVAFSQPGALMGPPTTQQVIVLRSEKPRPSSVHHHHHYSSTGMQQTLPQAPLPPI
GYPMWPPMMSSNPMGQTGGFPPSIHHMTGQPTALPALQ
Download sequence
Identical sequences H3AUV9
ENSLACP00000013430 ENSLACP00000013430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]