SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CH31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CH31
Domain Number 1 Region: 142-241
Classification Level Classification E-value
Superfamily Immunoglobulin 6.4e-17
Family I set domains 0.04
Further Details:      
 
Domain Number 2 Region: 22-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.87e-16
Family Growth factor receptor domain 0.0022
Further Details:      
 
Domain Number 3 Region: 95-139
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000177
Family Ovomucoid domain III-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CH31
Sequence length 262
Comment (tr|H3CH31|H3CH31_TETNG) Insulin-like growth factor binding protein 7 {ECO:0000313|Ensembl:ENSTNIP00000007559} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MKPVSAPLLLIPVLLALPARTAPGCGPCEPAVCAPLPLEGCRSGSVLDSCGCCSVCAAAE
GEACGGRRAGARRCAAGLECIKGNPDKKNKGGACVCKSDYEVCGSDGVTYSSGCELRSAS
LAAQAQGQQPVRVQNKGRCATAPLIVTPPGEVSNVSGSQVYLSCEATGVPTPVITWKKVL
SGKKKMELLPGDRENLAIQTRGGPEKHQVTGWVLISPLTKEEEGAYECRASNAKGEASAA
GKIHLVESHDDVIIRKGATKEA
Download sequence
Identical sequences H3CH31
ENSTNIP00000007559 99883.ENSTNIP00000007559 ENSTNIP00000007559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]