SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CIU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CIU4
Domain Number 1 Region: 378-407,498-609
Classification Level Classification E-value
Superfamily TIMP-like 1.8e-38
Family Netrin-like domain (NTR/C345C module) 0.0095
Further Details:      
 
Domain Number 2 Region: 289-347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000419
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 3 Region: 408-447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 4 Region: 98-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000561
Family APC10-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CIU4
Sequence length 610
Comment (tr|H3CIU4|H3CIU4_TETNG) Netrin 1a {ECO:0000313|Ensembl:ENSTNIP00000008172} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
ATTMGAVDLVPFALLAASLWCRGALGGYGMSMFAAQTSPSDPCYDEHAHPRRCIPDFVNA
AFGKEVKVSSTCGKTPGRYCEATPAEKGEERTRNCHTCDASDPKKYHPPAYLTDLNNPHN
LTCWQSENFIQYPQNVTMTLSLGKKFEVTYVSLQFCSPRPESMVIYKSMDYGKTWVPFQF
YSTQCRKMYNRPNRAAITKQNEQEAVCTDSHTDMFPLSGGLIAFSTLDGRPSAHDFDNSP
VLQDWVTATDIKVIFSRLHTFGDENEDDSELARESYFYAVSDLQVGGRCKCNGHASRCVK
DRDGSLVCECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMEL
YKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDLSKPISHRKACKACDCHPVGAAGKTC
NQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIRVEIPVTPPPTPPSSPEEPSGGGG
FFKTSKGRLKINMKKYCKKDYAVQIHILKADKAGEWWKFTVNIISVYKQGESRIRRGDQF
LWVRAKDVACKCPKIKPGKKYLLLGNDEDSPGQSGVVADKGSLVIQWRDTWARRLRKFQQ
REKKGKCKKP
Download sequence
Identical sequences H3CIU4
99883.ENSTNIP00000008172 ENSTNIP00000008172 ENSTNIP00000008172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]