SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CSV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CSV3
Domain Number 1 Region: 556-668
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.83e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.00039
Further Details:      
 
Domain Number 2 Region: 14-168
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.65e-28
Family G proteins 0.00000656
Further Details:      
 
Domain Number 3 Region: 680-772
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-17
Family Ankyrin repeat 0.0018
Further Details:      
 
Domain Number 4 Region: 290-357,496-541
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000201
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CSV3
Sequence length 808
Comment (tr|H3CSV3|H3CSV3_TETNG) ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 {ECO:0000313|Ensembl:ENSTNIP00000011337} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
DSFVNSQEWTLSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVD
GQSYLLLIRDEGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLSSYRNAAEVPMV
LVGTQDAISAANPRVIDDSRAKKLPNDLKRCTYYECSTYGLNVERVFHDGEHGVVKVVHL
NRGWILPDKQSGSQPKAKVNINKSKTFATLVALASGLGIQRGDKSLKASLILKHTQIQTR
SDTITHTQTPVSAHSDIPHKNTLYRSHEGNHGKASEQAKSVDSKTDSIGSGRAIPIKQGI
LLKRSGKSLNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKIPGKRPPR
AVATVAPTASPKTNGLAKDRSGLQLGIGNTGASHSNSSTSLQTGGLVFGGSKDGMHQRSF
SVSSADQWNEAINTSTSSGAPNGTSDPAGSSAGSATSPKLEPPPSPHANRKKHRRKKSTG
ITKPDGLSAGNEEQEDSFEFVIVSLTGQTWNFEASTYEEREFWVQAIESQIFASLQSCES
IKNKSRLGSQSDAMAIQSIRNVRGNSFCVDCDAANPDWASLNLGALMCIECSGIHRNLGT
HLSRVRSLDLDDWPVELSMVMTAIGNAMANSVWEGALENYNKPGNDSTREEKERWIRAKY
DQKLFLVGLPQSDVPLGQQLLRAVVEDDLRLVVLLLAHGTKEEVNETYGDGDGRTALHLS
CAMANVVITQLLIWYGVDVKSRDARGQTPLSYARRAGSQECADILLQHGCPNDSSSATLT
LAPNASLRNANPNINNNNAQCELNRSLS
Download sequence
Identical sequences H3CSV3
ENSTNIP00000011337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]