SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DJQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DJQ8
Domain Number 1 Region: 906-1076
Classification Level Classification E-value
Superfamily C-type lectin-like 4.08e-76
Family Endostatin 0.000000715
Further Details:      
 
Domain Number 2 Region: 30-228
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.1e-31
Family Laminin G-like module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DJQ8
Sequence length 1082
Comment (tr|H3DJQ8|H3DJQ8_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000020754} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
EGRCHSRLESILTVLPLTSSVVVEDRGPGGHLDLMQLIGVPLPPSVSFAPGFEGLPAYSF
GPHANIGRLTETFIPGPFYRDFAIIVTVRPANQTGGVLFAITDAQQKVVELGVALTPVRG
GLQSILLYYTEGQQPSHSRKAAAFTVPDMTEQWTRFTLVVEHEEVRLYMDCGEADRTRFH
RGPHRLAFSHNSGLFVANAGGAGLDKFVGSIQQLVIKDDPRAAEEQCEDDDPYWMKASGY
TSGDSSLDDRETEEEDHSVPVRAPPTEAPDMELDESSGRQSSTEAHVKPGIKGEPGDPGP
RGPPGPPGPIDAPGLGQGGTKGEKGEPGSRGHQGLPGFAGAKGEKGPPGPPGPPGPPGPP
LCIALQGDSGSVGIQGPPGPAGPQGREGPPGPPGPPGGDPGDPGPEGLAGPAGLPGARLQ
ASCWKSNQQGDGGEDGRSISGPPGPPGPPGPTANLPGFPDTFFFWLFSLLNMGPRGPKGD
MGPPGAQGLAGLKYKGEKGEPGVTIAADGSVISAPRGPQGPKGIRGERGFPGPDGPMGPV
GPPGQKGEYGFPGRPGRHGLPGRKGDRGEAVGLPFPQGPPGPPGPPGRIVYLNGVSFHLF
FSAWGSGTWGAKGDKGDVGLPGEPGTAENISLFQLSVQGSKGDQGHKGQKGEQGDSGSPG
PPGLPGRSGLVGPKGESVVGPPGPVGSPGPPGSPGLGRPGPRGPPGTPGAPGPAPAYGAA
RPAVNIPGPPGPPGPPGSPGYGGLVTNYKTIQALSKDAHRAAEGTLAFVAEKGGELYVRA
RNGWRKVQVRQLFLPLSGGPGGRPALRDLPPQQHHSRSVELENGTSPRGSTARSKHCHPQ
SLQMFVTLIHQSRAYKEERVWKQQDQAFTAPLKQRDAFLVKQELHDARRGYQPSYNVLPH
TFHAIPGLHLVALNNPLKGDMRGIRGADFQCYQQARAMGLTSTYRAFLSSHLQDLATIVR
KADRTDMPVVNLRGEVLFSSWMSIFSGNGGTFDPSVPIYSFDGRNVMTDPAWPEKLVWHG
SSTVGIRLTANYCEAWRTGDMAVTGQAALLQTGRLLGQHSRSCSNHYIVLCIENTYVGNT
HP
Download sequence
Identical sequences H3DJQ8
99883.ENSTNIP00000020754 ENSTNIP00000020754 ENSTNIP00000020754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]