SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DM91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DM91
Domain Number 1 Region: 242-432
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 9.42e-83
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.000000591
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily A heparin-binding domain 5.23e-38
Family A heparin-binding domain 0.0000378
Further Details:      
 
Domain Number 3 Region: 92-155
Classification Level Classification E-value
Superfamily Amyloid beta a4 protein copper binding domain (domain 2) 4.58e-26
Family Amyloid beta a4 protein copper binding domain (domain 2) 0.0000584
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DM91
Sequence length 598
Comment (tr|H3DM91|H3DM91_TETNG) Amyloid beta (A4) precursor-like protein 1 {ECO:0000313|Ensembl:ENSTNIP00000021639} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
QIAMFCGLQMLHMNLQTGQWEPDPQGRQGCFKDSHEILSYCQEMYPALTISHVEESKKPF
TIHAWCKKGWSRCQTHPFIVLPYRCLSGEYVSESLLVPDKCRFLHQEQMDTCKSYVYWHN
IAKQECTAENLELHSYGMLLPCGDHFRGVEYVCCPGRGSSSGKGEADERDEPAAQTYTSQ
SAGKLNSITRVMAPTPSPSSDTDVEEADMEEEDDEVKEAANPPTSAPVMKGESLTTPRPT
DGVDVYFEKPADDTEHANFLRAKTDLEERRMKRINKIMKEWAEADNQSKNLPKTERQALN
EHFQSVLQTLEEQVAGERQRLVETHLVRVEAILNNNRRLALENYLAAVQSNPPQPERVLQ
ALKRYMAVEQKDRRHTLTHYQHIVTVDPQKAEQMKFQVYTHLHVIEERMNQSLALLYKDP
SLAEELHDDIQELVKAERGDISELMTTSFSETRTTEELVPAENRPYPPRIALMSSVDEYD
YTTSERGPTYEYEEKINTSVELKQVVNKPPEIERDELQPDALETFNRGAMVGLLVVAVAI
AMVMVISLLLVRRKPYGTISHGIVEQVDPMLTPEERQLNKMQNHGYENPTYKFFEQMN
Download sequence
Identical sequences H3DM91
ENSTNIP00000021639 ENSTNIP00000021639 99883.ENSTNIP00000021639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]