SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H8LPT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H8LPT0
Domain Number - Region: 22-67
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.00745
Family RecG, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H8LPT0
Sequence length 104
Comment (tr|H8LPT0|H8LPT0_RICSL) Uncharacterized protein {ECO:0000313|EMBL:AFD20126.1} KW=Complete proteome OX=1105109 OS=Rickettsia slovaca str. D-CWPP. GN=MC3_06285 OC=Rickettsiaceae; Rickettsieae; Rickettsia; spotted fever group.
Sequence
MLISDSYNLSLNKRIEIIEYLIDKYKNDTKSIYYITQQLFDICDDNTDIKTLEAKAKQFY
KYIEYFRSWDDLPSYWYMDFKGLSGCDKEALIMGNSVKPENDYI
Download sequence
Identical sequences H8LPT0
WP_014419930.1.54264 WP_014419930.1.55704 gi|383751756|ref|YP_005426857.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]