SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9BV41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9BV41
Domain Number 1 Region: 42-249
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 2.38e-114
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000000069
Further Details:      
 
Domain Number 2 Region: 2-41
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 7.06e-16
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H9BV41
Sequence length 251
Comment (tr|H9BV41|H9BV41_9EURY) Methyl-coenzyme M reductase alpha subunit {ECO:0000313|EMBL:AFD09520.1} OX=176306 OS=uncultured Methanobacterium sp. GN=mcrA OC=Methanobacteriaceae; Methanobacterium; environmental samples.
Sequence
KQIGMSMISAYKQAAGEAATGDFAYAAKHAEVIHMGTYLPVRRARGENEPGGLAFGFLAD
IVQTPRKYPDDPVRQTLDVVAAGAMLYDQIWLGSYMSGGVGFTQYATAAYTDNILDDFTY
FGKEYVEDKFGITEAPNTMDTVLDVASEVNFYALEQFEDYPALLETIFGGSQRASLVAAA
SGCSTAFATGNAQTGLSGWYLSMYLHKEQHSRLGFYGYDLQDQCGASNVFSIRGDEGLPT
ELRGANYPNTQ
Download sequence
Identical sequences H9BV41

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]