SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9EEU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9EEU9
Domain Number 1 Region: 2-138
Classification Level Classification E-value
Superfamily Bacteriophage trimeric proteins domain 1.15e-74
Family Lactophage receptor-binding protein N-terminal domain 0.000000214
Further Details:      
 
Domain Number 2 Region: 162-264
Classification Level Classification E-value
Superfamily Virus attachment protein globular domain 2.94e-40
Family Lactophage receptor-binding protein head domain 0.00000791
Further Details:      
 
Weak hits

Sequence:  H9EEU9
Domain Number - Region: 141-161
Classification Level Classification E-value
Superfamily Phage fibre proteins 0.0314
Family Lactophage receptor-binding protein domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H9EEU9
Sequence length 264
Comment (tr|H9EEU9|H9EEU9_9CAUD) Putative receptor binding protein {ECO:0000313|EMBL:AFE87383.1} KW=Complete proteome OX=1165145 OS=Lactococcus phage ASCC368. GN=LLAPH_368_0021 OC=Viruses; dsDNA viruses, no RNA stage; Caudovirales; Siphoviridae.
Sequence
MTIKNFTFFSPNGTEFPVGSNNDGKLYMMLTGMDYGTIRRKDWTSPLNTALNVQYTNTSI
IAGGRYFELLNETVALKANSTNYIHANIDLTQTANPVSLSAETANNSNRVDINNGSGVLK
VCFDVVVTSETGVTSTQPIVQTSNLDSISANDISLKGPIHVPVQTSTVQTAPGLQLQLTK
KNDDLVIVRFLGSVANIKKGQTMSRTWVDEPFRPAIVQSLIGHLIGSDSIFHIDINPDGS
ITWWGEDVGSHPFSSRGNASYFIK
Download sequence
Identical sequences H9EEU9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]