SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9J3I0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9J3I0
Domain Number 1 Region: 27-83
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 4.71e-18
Family Chemosensory protein Csp2 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H9J3I0
Sequence length 85
Comment (tr|H9J3I0|H9J3I0_BOMMO) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:BGIBMGA004067-TA} KW=Complete proteome; Reference proteome OX=7091 OS=Bombyx mori (Silk moth). GN=778483 OC=Bombycoidea; Bombycidae; Bombycinae; Bombyx.
Sequence
MEDSCYSTPDEKSIAKAIDTVVQGTSLKNVLEENCDKCSEDQRKSIIKVINYLVSSEPES
WNQLKSKYDPEGKYLIKYEAKMESN
Download sequence
Identical sequences H9J3I0
Bmb018110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]