SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I1GKW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I1GKW2
Domain Number - Region: 127-169
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.000968
Family N-terminal coiled coil domain from apc 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1GKW2
Sequence length 217
Comment (tr|I1GKW2|I1GKW2_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQK12119.1, ECO:0000313|EnsemblPlants:BRADI1G01720.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_1g01720v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MIQLLFLVLFAEGAVALLLMVKVGPLRELAMRTVEQVKTGKGPATVKTLACTLSVIFMSS
VASILKIQNRGLKLGTVSPMDQVLWRTHLLEASLIGYTLFLAFVIDRLHHYLQKLITLRK
TANTSREEVEKLQMENRSFREKEEKSSSEIKKLQQDIAKLTEGMKKMKSESDDNERKALE
AEAHVNALQKQSEELLLEYDRLLEDNQILQSQLHYKG
Download sequence
Identical sequences I1GKW2
XP_003562352.1.954 EG:BRADI1G01720.1 15368.BRADI1G01720.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]