SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I1JKU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1JKU5
Domain Number 1 Region: 2-140
Classification Level Classification E-value
Superfamily PapD-like 2.88e-46
Family MSP-like 0.0012
Further Details:      
 
Weak hits

Sequence:  I1JKU5
Domain Number - Region: 178-212
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0131
Family Moesin tail domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1JKU5
Sequence length 241
Comment (tr|I1JKU5|I1JKU5_SOYBN) Uncharacterized protein {ECO:0000313|EMBL:KRH65384.1, ECO:0000313|EnsemblPlants:KRH65384} KW=Complete proteome; Reference proteome OX=3847 OS=Glycine max (Soybean) (Glycine hispida). GN=GLYMA_03G032100 OC=Phaseoleae; Glycine; Soja.
Sequence
MSSGELLHIQPQELQFPFELRKQISCSLQLSNKTDNYVAFKVKTTNPKKYCVRPNTGVVM
PRSTCDVIVTMQAQKEAPPDMQCKDKFLLQSVVASPGATTKDITPEMFNKESGHDVEECK
LRVVYVAPPQPPSPVREGSDEDSSPRASVSENGHSSAAEFTGASKAFNERGEHQDASFEA
RALISKVTEERNSIVEQNRRLQQELELLRRDAGRSRGGVPFIYVVLVGIIGLILGFLLKR
T
Download sequence
Identical sequences A0A0B2S3P7 I1JKU5
Glyma03g03800.1|PACid:16251031 XP_006576144.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]