SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I1X8X1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1X8X1
Domain Number 1 Region: 35-195
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 1.94e-80
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000000806
Further Details:      
 
Domain Number 2 Region: 1-34
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 0.000000000000981
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1X8X1
Sequence length 195
Comment (tr|I1X8X1|I1X8X1_9EURY) Methyl coenzyme M reductase {ECO:0000313|EMBL:AFI79965.1} OX=198240 OS=uncultured methanogenic archaeon. GN= OC=Archaea; Euryarchaeota; environmental samples.
Sequence
ITAYRMCAGEAAVADLSYAAKHAGVIQMASHLPARRARGPNEPGGILFGHFADMIQADRV
NPKDPAKATLEVVGAGAMLFDQIWLGSYMSGGVGFTQYATAAYTDNILDEYTYYGMDYIK
DKYKVDWQNPSPKDKVKPTQDIVNDIATEVNLNGMEQYEQFPTALESHFGGSQRASVLAA
ASGISVAIATGNSNA
Download sequence
Identical sequences I1X8X1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]