SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I1XEF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1XEF5
Domain Number 1 Region: 2-107,141-164
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.05e-22
Family Nucleotide and nucleoside kinases 0.00034
Further Details:      
 
Domain Number 2 Region: 104-140
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.000000115
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1XEF5
Sequence length 173
Comment (tr|I1XEF5|I1XEF5_9MOLU) Adenylate kinase {ECO:0000256|RuleBase:RU003331} OX=2105 OS=Mycoplasma leachii. GN=adk OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
NKLNFIQVSTGDLMRKEISLNTELGLKCQEYMNAGKYVPDEIVNQIVSQFLKHTNNKLIF
DGYPRTLEQAKSLEKMLDLYNKKIDYVFYIDVNDQILIKRITNRLVCPFCKASFNLETRK
PKQEDLCDFDNTKLVKRSDDSLDKVKIRLQTYNEQTLPLIDYFKTNSKFIEIK
Download sequence
Identical sequences I1XEF5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]