SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I1YKY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1YKY9
Domain Number 1 Region: 183-312
Classification Level Classification E-value
Superfamily CBS-domain pair 4.25e-27
Family CBS-domain pair 0.0041
Further Details:      
 
Weak hits

Sequence:  I1YKY9
Domain Number - Region: 138-192
Classification Level Classification E-value
Superfamily YfbU-like 0.0759
Family YfbU-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1YKY9
Sequence length 345
Comment (tr|I1YKY9|I1YKY9_METFJ) Magnesium and cobalt efflux protein CorC {ECO:0000313|EMBL:AFJ03582.1} KW=Complete proteome; Reference proteome OX=754477 OS=Methylophaga frappieri (strain ATCC BAA-2434 / DSM 25690 / JAM7). GN=Q7C_2457 OC=Piscirickettsiaceae; Methylophaga.
Sequence
MSLLIAFAILSIAASFLCSVLEATLLSITPSYIAQQRSERPRLYSKLNRLKEKIDQPLAA
ILTLNTVAHTVGALGVGAQVTVVFGSGYLGVASAVMTILILVLSEILPKTIGARYWRSIA
PLLPSVLNTMILVLKPFIWMSDWIMKILDNTSEQQGDTRQEIKAMAQLGHELGELDDDES
RVILNVLDLHDMKIRDIMTPRTVCEYVYPEETVAEFMSQYARGQFSRYPVLSAEDESPLG
VVFRRDIIGVEDDKLMQDVMMKSPLIVTDHMDVESVMTQLMREHQHMAMVFDEYGTWMGI
VTMEDIFETLIGKSIVDETDDIPNMRRFARKRWEKRRRQQSRQYD
Download sequence
Identical sequences I1YKY9
WP_014705000.1.84016 gi|387131379|ref|YP_006294269.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]