SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I2E1Q0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I2E1Q0
Domain Number - Region: 154-198
Classification Level Classification E-value
Superfamily Stathmin 0.0209
Family Stathmin 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I2E1Q0
Sequence length 219
Comment (tr|I2E1Q0|I2E1Q0_RHIML) IS4 family transposase {ECO:0000313|EMBL:AFJ91418.1} OX=382 OS=Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti). GN=pHRC017_0295 OC=Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
Sequence
MLDPARRLRAGATPDPRLDAQCRGADGVRFDIAVPDFSTLSRRSKGLALPSTKSRAITSG
PVHLVVDSTGLKVFGEGEWLENKHKTKAKRKRWRKLHLGLKLVSGEIVCSDLTADDVGDP
TALPGLLDQIGGPVEKFIADGAYDGTPTRDLLATRSGEIVEVIIPPPKTAVASPQSVLVP
PVRDRHIAEIQIKGRMAWQKSTGYNKRSRAETQMGRWKL
Download sequence
Identical sequences I2E1Q0
gi|410689136|ref|YP_006962740.1|NC_019313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]