SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I2J4D2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I2J4D2
Domain Number - Region: 10-44
Classification Level Classification E-value
Superfamily Fe-only hydrogenase smaller subunit 0.0654
Family Fe-only hydrogenase smaller subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I2J4D2
Sequence length 124
Comment (tr|I2J4D2|I2J4D2_9STRE) Uncharacterized protein {ECO:0000313|EMBL:EIF37834.1} KW=Complete proteome OX=1095727 OS=Streptococcus sp. SK643. GN=HMPREF1117_0793 OC=Streptococcus.
Sequence
MENNTRIQPYMTESTYSQELSSQNDAMNQVYKDYILDYHFEKADIFVNQTTNQAIAMISY
EVRTGKETDITTSYQQDLKRLIADNNSDIQSSQKKIEELHTLIDTKNKDNKKLQSIYDAI
SELH
Download sequence
Identical sequences I2J4D2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]