SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I2UJY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I2UJY4
Domain Number - Region: 106-170
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 0.00194
Family Tubulin chaperone cofactor A 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I2UJY4
Sequence length 242
Comment (tr|I2UJY4|I2UJY4_ECOLX) Uncharacterized protein {ECO:0000313|EMBL:EIH78510.1} KW=Complete proteome OX=869681 OS=Escherichia coli 4.0522. GN=EC40522_A0126 OC=Enterobacteriaceae; Escherichia.
Sequence
MMSEKVKDNSSINETELKSFSEIIKDKIFNKVFAYVVISFLILNWKDILIILKSKDDILY
TLSIVFVGGNVPFFDNWIVPPWVCHVVIPFIYGVFASVLAPILTLTISKLTSKLYTEIRY
LDEVADYDKRIELQRKKTKLNQATNDAKYSKQILDENENKLNDLVTKQREICGAIKLLHT
DVGSIIELYKNKGVSIESPQDLCDFIVAIKSTSFYNDDKHFNKLVSDISSLFDNTGIDLS
KK
Download sequence
Identical sequences I2UJY4
WP_000986757.1.11616 WP_000986757.1.48910 WP_000986757.1.68609 WP_000986757.1.70149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]