SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I2W4E1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I2W4E1
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily mu transposase, C-terminal domain 2.75e-18
Family mu transposase, C-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I2W4E1
Sequence length 158
Comment (tr|I2W4E1|I2W4E1_ECOLX) Mu transposase, C-terminal domain protein {ECO:0000313|EMBL:EII19519.1} KW=Complete proteome OX=869686 OS=Escherichia coli 9.0111. GN=EC90111_3936 OC=Enterobacteriaceae; Escherichia.
Sequence
MVERPVRRCEIRWLNNIYYAPELRDEHGRKVLISYDIHDAERITVRRLDGSVICEAVWDG
NKREAFPVSAEYYKQQQRLKGMRKRAEEKIRDAEDEVVNVLEHKPQEPWLENIYRPVGNT
VTVQQPVADDEPDEEYERNFQRGLQLLEAKLKENDPLA
Download sequence
Identical sequences I2W4E1
WP_001371695.1.16861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]