SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3ERV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I3ERV0
Domain Number - Region: 37-61
Classification Level Classification E-value
Superfamily Multimerization domain of the phosphoprotein from sendai virus 0.0209
Family Multimerization domain of the phosphoprotein from sendai virus 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3ERV0
Sequence length 64
Comment (tr|I3ERV0|I3ERV0_NEMP1) Uncharacterized protein {ECO:0000313|EMBL:EIJ94608.1} KW=Complete proteome OX=881290 OS=fungus). GN=NEPG_00130 OC=Eukaryota; Fungi; Microsporidia; Nematocida.
Sequence
MNTTESFNDLFDFIQSTPNVMTTINSYTDEDWGMGWDEQASIKSIKQELEGFSEIYKRIT
YNPN
Download sequence
Identical sequences I3EE79 I3ERV0
XP_013057964.1.1480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]