SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3JR41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JR41
Domain Number 1 Region: 2-159
Classification Level Classification E-value
Superfamily UBC-like 6.06e-52
Family UBC-related 0.000000147
Further Details:      
 
Domain Number 2 Region: 157-198
Classification Level Classification E-value
Superfamily UBA-like 1.65e-21
Family UBA domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3JR41
Sequence length 200
Comment (tr|I3JR41|I3JR41_ORENI) Ubiquitin-conjugating enzyme E2Kb (UBC1 homolog, yeast) {ECO:0000313|Ensembl:ENSONIP00000011335} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=ube2k OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEI
KIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAA
EPDDPQDAVVANQYKQNPEMFKQTARLWSHVYAGAPVSSPDYTRKIDKLCAMGFDKNAVI
AALSSKSWDVETATELLLSN
Download sequence
Identical sequences A0A087XX52 I3JR41
ENSONIP00000011335 ENSPFOP00000010355 ENSONIP00000011335 XP_003452184.1.78416 XP_004564367.1.88231 XP_005741198.1.53837 XP_005928351.1.24487 XP_005928352.1.24487 XP_006787309.1.46954 XP_007551984.1.10163 XP_008276622.1.38333 XP_014836348.1.96476 XP_014836349.1.96476 XP_014887839.1.100837 XP_014887840.1.100837 XP_015252542.1.42780 XP_016526906.1.10163 XP_018551228.1.34915 XP_020457791.1.23826 XP_022061776.1.10920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]